DPCstruct | MC42017
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 82 ± 10 aa |
| Standard deviation of domain lengths | 9.78 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 94.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 45.21 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0179- CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845RVF0 | 1-70 | YTGTMCVEFFVTRKNELLVNEIAPRVHNSGHLTMNAHNVSQFENHIRAVCNLKLIKPKRIHKAIMYNILG |
| A0A7Y1X380 | 1-82 | MQSTFPGCGIFGVEMFYLETGELLINEIAPRPHNSGHYTIDACVTSQFEAHLRSILDLPMPKNFTSFSTITTNAIMLNVLGD |
| F9DEA1 | 28-116 | None |
| A0A4U0XDE6 | 429-532 | None |
| A0A287KIE9 | 1-101 | None |
| A0A536C0G7 | 430-504 | None |
| A0A840R914 | 5-76 | None |
| N1U980 | 8-90 | None |
| A0A6P5UIJ7 | 443-517 | None |
| A0A812PN94 | 90-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.