DPCstruct | MC42016
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 120 ± 22 aa |
| Standard deviation of domain lengths | 22.09 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 37.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F9K5D4 | 42-151 | PVPFTFTDDPLTAQVTPVKAVHVTELRQDIDTLRSRNGLGAFTYTDPTLTVGATQVKTAHITELRTALNAVYDAQGKTQPTYTDPTI… |
| A0A645F6P3 | 46-222 | KIDAGAWINSVDSPERFSAGGYLGNSAKTVFQPETLAAGSHSITIRCLDSDTESASPEVTRAFTVLPTPFETITANETHVKAAHIQT… |
| A0A2V7WDA6 | 607-730 | None |
| A0A7Y4UAX0 | 183-289 | None |
| A0A2V7YEP7 | 35-166 | None |
| A0A410P797 | 3-109 | None |
| A0A2V7BM22 | 66-204 | None |
| A0A2V7XN09 | 599-697 | None |
| A0A2V6YXZ7 | 1-90 | None |
| A0A1F6WYH3 | 203-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.