DPCstruct | MC42010
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 208 ± 37 aa |
| Standard deviation of domain lengths | 37.17 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 93.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 45.19 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1F5XGB6 | 39-216 | LNGLKTKLVAAGVIDKKRSENRLNLLWAFGLANKNEILEKGPMANLRYDTGRFASTGGWIPAQGGAMDHYSRYEFIKLTDTQQKLVE… |
| A0A2M8KKR5 | 1-156 | MISSGVIDLDKFKQTYEKSSQPLTKEQLEILTKGSDKKIKIDRDNSYFLLNFFWAVGLNNKSKVLDEGDIVKYGEGKVGNFASTGGW… |
| A0A1F8CLQ8 | 1-180 | None |
| A0A0G1L3U6 | 43-207 | None |
| A0A0G0U543 | 24-213 | None |
| A0A7T5RLW7 | 41-253 | None |
| A0A2M7WT53 | 3-127 | None |
| A0A1G2RSN0 | 291-525 | None |
| A0A1F6BSX9 | 27-275 | None |
| A0A7J4IVL2 | 165-375 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.