DPCstruct | MC4201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 117 ± 10 aa |
| Standard deviation of domain lengths | 9.75 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 67.58 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.52 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 34.79 |
| Pfam Score | 86.61 |
| Assigned Pfam label(s) | PF08550- PF11702 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1X2HSY4 | 1-100 | MPLDVPVVSLALPNIHKLKDITSDDLSCMWTVFTKCKDNLENGRRLENMSWRLWYRESNAERDEKTAPTVRTPIPIPALSPDDSHDD… |
| R7SS67 | 1-111 | MVSTFPSPILSVAADVVKDIEGEDALCSLWALFTKCKESLKDGRRLENISWRLWYRELASAQCTPSSSPGTLSPPFSEKRSPSPVTP… |
| A0A1S8VS95 | 1-125 | None |
| A0A6A6AZM1 | 1-124 | None |
| A0A166LD23 | 1-131 | None |
| A0A2T6ZLE6 | 1-128 | None |
| A0A0C3NRH9 | 1-113 | None |
| X0C4D0 | 1-111 | None |
| S8ER77 | 1-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.