DPCstruct | MC42008
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 106 ± 16 aa |
| Standard deviation of domain lengths | 16.48 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00940 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3VJR5 | 2-96 | ESQRAVDAAAGMPVAQALEGFVQRKVIKQSVMTTVYGVTLYGAMAQIRRQLKEIPEFPRERWLGPASAYLARLTLASISAIFTSSSE… |
| A0A1D6IJW8 | 58-204 | YTGIANRVMEIMRMDAQKDPSVEPDAARARLIVDQVDRKLVKQTVMTSVYGVTYIGAREQIRRRLKERGVIPNDSELFGASCYAAKV… |
| A0A183WN36 | 99-192 | None |
| S4RK49 | 749-877 | None |
| M1V872 | 982-1082 | None |
| A0A445CUN6 | 13-94 | None |
| A0A0V0YC22 | 350-457 | None |
| A0A367YHJ4 | 70-199 | None |
| A0A7G2CKF4 | 870-1014 | None |
| A0A6P6BMJ6 | 539-634 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.