DPCstruct | MC42007
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 148 ± 16 aa |
| Standard deviation of domain lengths | 16.15 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.16 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 39.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0423 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3RVF5 | 2-134 | LVDRLASDLGSMLDDEFCNAYELTYNTLNTLTNVDTAPYRHAVWNFVQSLFGICHEDVRFDKLNSFFREPQRAFLKACCTRPADLCQ… |
| A0A813TAV2 | 434-575 | DQSLRLEYYTWENQGYCTALSLYPDICDYLDRNFKIAVNMTYNTMGTKKDVDTSLFRRAVWHYVHSLYGVQYDDYDYSQIRILLKSP… |
| A0A556TPD4 | 723-873 | None |
| A0A183NYW8 | 75-223 | None |
| A0A2P6NL48 | 355-498 | None |
| A0A1X2IKI8 | 764-917 | None |
| A0A182FGE2 | 321-465 | None |
| A0A7S1P2F4 | 1-156 | None |
| A0A077WMN1 | 635-774 | None |
| A0A7J8KGK6 | 252-405 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.