DPCstruct | MC42006
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 103 ± 11 aa |
| Standard deviation of domain lengths | 11.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 39.15 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4U5ME32 | 150-228 | LTVDEKELLKNQNGGLQTFLKNHHQIFKVIGGKVKIKNWREELELAPLKKNHVKKSECWFLRNHPDGCPLSEETCRFAH |
| A0A504YBI1 | 1-95 | MKSQHGGLQTLLKNHHQAFEIRSGLIRLRFDPERMAQLNPSGGSFVLRKPAKKRLIHRKTKPCWMFSHHVDGCPYPSETCDFLHKTE… |
| A0A2C9K731 | 482-609 | None |
| A0A0R3T7M4 | 558-664 | None |
| A0A4Y1ZXK7 | 92-211 | None |
| A0A5E4C7L4 | 469-569 | None |
| A0A182WBK6 | 523-638 | None |
| A0A0V0X5J0 | 678-779 | None |
| A8P0B4 | 216-316 | None |
| A0A6P4WEU0 | 554-660 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.