DPCstruct | MC42005
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 202 ± 20 aa |
| Standard deviation of domain lengths | 19.87 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.90 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7M3RHU3 | 19-213 | DFETEPNSYFAFMQPFSQRPQSITTEGQTVPEGSQSTPCEVGISCWQPLTDKQFSYLSVGPENGTGVIILVPAAGIRLPTAVIVRDV… |
| A0A7M3QVA8 | 28-225 | RFEFRRDSDYVFLYKLYEGVKYISVDGVNISKAGEGSNCVAPNDCWQLIRRGRYLIVLGVLKGTQAAFTVQPVNPSNRLSVGFQYKK… |
| A0A3P6TNG4 | 4-197 | None |
| A0A3P6R0V6 | 2-221 | None |
| A0A3P6PLY4 | 2-199 | None |
| A0A068YE37 | 26-237 | None |
| A0A654HVS6 | 17-236 | None |
| A0A654HP37 | 1-185 | None |
| A0A654HVB9 | 23-212 | None |
| A0A7M3RNU7 | 135-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.