DPCstruct | MC42000
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 226 ± 17 aa |
| Standard deviation of domain lengths | 16.86 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 24.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A8RG54 | 3-268 | LADRLLGMVVRGFDYLPVVDVTFGDVVRATVTADRRLYPEDRQHLRSMLVEAFRRRGIWPKNVTSLTDDALVWVQPDSGLQLTGSVD… |
| A0A3S9DWL2 | 336-554 | IAIQALDLLPPVEVTFNDYARAVLRNLAIADPTDPHGYRKMIADIFVAREIISCDEGKALLEPAPLYDRMPGAIAHDPELIGSSRAE… |
| A0A7C1DSD9 | 591-857 | None |
| A0A1Q6X450 | 12-215 | None |
| A0A7Y0PAR4 | 892-1112 | None |
| A0A1M6IG93 | 952-1173 | None |
| B4WCZ3 | 798-1040 | None |
| A0A7V9NI35 | 48-267 | None |
| A0A857JDX4 | 403-620 | None |
| Q2IGE8 | 721-957 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.