DPCstruct | MC4200
Metacluster Properties and Pfam Annotations
| Number of structural domains | 109 |
|---|---|
| Mean domain length (aa) | 242 ± 51 aa |
| Standard deviation of domain lengths | 50.86 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 79.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 20.54 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20414 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| R7SHN2 | 9-258 | DYLLRDPDRVRNYGKYVNSRVRARRRDDCGKFRDEVLNLMRHIPEFAHLNIVHIEKAERGWKNDLTARLLCPMQLIPRFDRDPTQFR… |
| A0A0D0BG22 | 91-371 | KEDIIKNYGRKFSVTHCLWVETTIFPLRAPPPNIDLRSKERWLSPMSIQDGVKAELFRFILPADHGMMAHKNFGSHFVKGINSVRAE… |
| F8NJG2 | 9-210 | None |
| F8NGC9 | 42-265 | None |
| F8NF02 | 157-377 | None |
| A0A6A4GSD8 | 89-440 | None |
| A0A6A4GKT6 | 31-278 | None |
| F8NZJ6 | 155-420 | None |
| A0A1B7N470 | 4-236 | None |
| A0A0C3C120 | 51-345 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.