DPCstruct | MC420
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 117 ± 15 aa |
| Standard deviation of domain lengths | 14.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 35.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0DI97 | 1-122 | MIANECPYFDSCNAPICPLDENKEKAIWYSDEAICKNRDFFDLEYIKTQKKIAKVNKTHNVKGYFTLKMLNQKIIIRSGIQGINEDT… |
| A0A2G9XM01 | 6-112 | RPLCSLYESCNAPLCPLDQASLNGIWYSDEESCRSRTHGSLPWIQAQRKLSRVAATGFFTVEMMTSLAVIRKGITGLDPNASKQEQL… |
| A0A1G3QT97 | 9-127 | None |
| A0A497ID62 | 23-131 | None |
| A0A7J3TB33 | 25-162 | None |
| A0A1J5IAQ1 | 195-315 | None |
| T0LL96 | 1-116 | None |
| A0A3A5ASE4 | 1-110 | None |
| A0A5A8F7H8 | 11-126 | None |
| A0A351ZB23 | 4-107 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.