DPCstruct | MC42
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 136 ± 14 aa |
| Standard deviation of domain lengths | 13.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 85.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.57 |
| Mean intra-cluster sequence similarity (%) | 16.60 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X9HBE2 | 60-171 | IQYLGGFLLSTNGDDSFGIEQYLSSNKRFLMLFTGKHLIRDVLEIDKKELENRILTEYCITKNGLETEIIALVNPTETEFHTKIIKA… |
| A0A372DT27 | 12-153 | RGWVGKIVPPYPDGVVETAGSCIGDPAAAPAALCDHAIAVLHDPQSGLRTILALTQAPHFGKQPLWRIADALEPGELDDRGVEVATA… |
| A0A351L4E8 | 76-207 | None |
| A0A095V088 | 31-166 | None |
| A0A246FG97 | 9-144 | None |
| K9PU90 | 9-170 | None |
| A0A5B7R0C6 | 284-435 | None |
| A0A6I4IVU6 | 16-150 | None |
| A0A3A6P6A7 | 34-168 | None |
| A0A7Y7NXP8 | 108-253 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.