DPCstruct | MC41998
Metacluster Properties and Pfam Annotations
| Number of structural domains | 280 |
|---|---|
| Mean domain length (aa) | 210 ± 44 aa |
| Standard deviation of domain lengths | 43.58 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 81.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.46 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 15.25 |
| Pfam Score | 94.59 |
| Assigned Pfam label(s) | CL0023- PF14332- CL0304 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3F2U3S5 | 3-222 | QELAQAAVTTRTGVLRVTGEPGGDLHVVHGLVVTVDSPGAPGVRELLARPGRTTTGAAELEVVAMMAAIDGCFAIASGWIGSCFWQA… |
| A0A221T3I9 | 3-167 | KGPLSDVSLISILMLLRENKHSGVLHVNSDVPMTMTLSSGELIDGCVLDWTGLEAVQTTPLDPNVGHFHFVKGDVEGEPLGFFDAVI… |
| A0A538Q002 | 4-257 | None |
| A0A7C5J2U3 | 675-891 | None |
| B9XDL9 | 280-541 | None |
| A0A2Z4FMR3 | 161-347 | None |
| A0A348XFN2 | 130-311 | None |
| A0A656HFC2 | 2-124 | None |
| A0LIT0 | 125-309 | None |
| A0A523DYR3 | 3-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.