DPCstruct | MC41993
Metacluster Properties and Pfam Annotations
| Number of structural domains | 563 |
|---|---|
| Mean domain length (aa) | 103 ± 21 aa |
| Standard deviation of domain lengths | 21.11 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 83.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 23.23 |
| Pfam Score | 99.45 |
| Assigned Pfam label(s) | CL0123- CL0004- CL0302 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A426TSN1 | 4-88 | QRTYTIRVAAQLAGLHEQSLRAYERRGLINPARSKGNIRRFSDADLEQIRFIKRLVDDLGVNLAGVEVIIQLRHQLLEAHRELHE |
| A0A538L9E3 | 19-94 | LDKVELYLGQVCQIAGISKMQLDYWTNKAQIPTKGKKQRIYDIDALETVMLIKQAKDKGLNLGAAIDAARRFREQN |
| A0A1M3FCM7 | 1-110 | None |
| A0A1Q6Y6L2 | 1-128 | None |
| A0A4Q5IXX1 | 2-67 | None |
| A0A378B105 | 124-238 | None |
| A0A7C5YNL6 | 3-87 | None |
| M1TV07 | 35-166 | None |
| A0A2V9TM61 | 1-87 | None |
| A0A7C4LWY6 | 93-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.