DPCstruct | MC41986
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 131 ± 14 aa |
| Standard deviation of domain lengths | 14.33 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 28.99 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0489 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819RYQ7 | 10-131 | ADLCENDDLATMIIVDSMFGFTTHKMNVRFRPNRRLSPQWKSAIEKFQQHLDYEQCFTELTSIGNWYDHLLARKSSAQLTAFKEHMF… |
| A0A183V5H7 | 1-126 | MTAQELCDNDDLATSVIVDTMLGFKTHKMSLSYEPPDARERRKLKKVLKAYIREQNLSNTMAKLLRAPCVCSFMCQLDMRQQINFRD… |
| A0A2H2IIR4 | 34-164 | None |
| A0A2T0FDP8 | 2-127 | None |
| A0A817KLX2 | 1-97 | None |
| A0A3Q0KGS1 | 16-151 | None |
| A0A0N4ZBK7 | 31-157 | None |
| A0A5N6XQM0 | 1-150 | None |
| A0A6P8HEA0 | 1-140 | None |
| F1Q9U2 | 2-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.