DPCstruct | MC41983
Metacluster Properties and Pfam Annotations
| Number of structural domains | 5 |
|---|---|
| Mean domain length (aa) | 80 ± 5 aa |
| Standard deviation of domain lengths | 4.88 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 91.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 38.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819Q4J1 | 1-73 | MSSNRSMKCDTIWRDEYAEVDLVLNVENIRRAAGMLGQHVTLCPIEKATHDVFLSKKPVREQAFKCMFQWLEN |
| A0A6M4A8B0 | 30-106 | HAEHSLRATAWSEDLLSADIVLDVADMQRLAPALGLQVERHAIAGGIHDLVLSRPTARHQVWQLLGAWLARVRASGA |
| A0A821D9N0 | 237-318 | None |
| A0A838FXB0 | 48-134 | None |
| A0A1P8U657 | 122-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.