DPCstruct | MC41982
Metacluster Properties and Pfam Annotations
| Number of structural domains | 532 |
|---|---|
| Mean domain length (aa) | 143 ± 26 aa |
| Standard deviation of domain lengths | 25.52 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 75.71 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.52 |
| Mean intra-cluster sequence similarity (%) | 19.23 |
| Pfam Score | 99.12 |
| Assigned Pfam label(s) | CL0192- CL0125- CL0361 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A819Q0M0 | 19-172 | LQRCDTNDKRHLLVSGDLIEYVRGPFSHWAVYLGNNQIAHLPGPSNIFANFQAFQIIWRILSGHWIEQMQIEICDFNSLLSSSIAYV… |
| A0A5J5CTT6 | 97-200 | PENLLNKCKAGDLVEFVATGQFPHWAVYVGDFQVVHLHRAEVKNSFLTDASQGRRCRVVNDLYKFKSLGPDMVVQNAMEQVGLKDRE… |
| A0A164NX98 | 50-161 | None |
| A0A6I9YI20 | 4-122 | None |
| A0A6G0X8W7 | 620-804 | None |
| A0A7J6D776 | 1-126 | None |
| A0A1S3PL86 | 221-374 | None |
| A0A1Q3D9L6 | 10-172 | None |
| A0A7R8XCZ4 | 1-143 | None |
| A0A086KUG1 | 837-981 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.