DPCstruct | MC4198
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 133 ± 12 aa |
| Standard deviation of domain lengths | 11.56 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 80.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 26.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182QMP5 | 9-124 | ITNVPCTCAIFLTGQFNRFNRTEQPKGNPGIQLELMQHFPCTTSGNKQCSNKCLDAIVKHLPNSQNVICATIDRDCFRERAYLFYQN… |
| T1IEW5 | 26-141 | LAGRYVTSASIDQACTCAIMNGDTVDAPVLEQTFNIAFTCDEEGKQTCRNLCVSLAEAAKSSGTGSLMLCEHIEEDTEIYVTVFSKV… |
| A0A7J6YNV7 | 16-157 | None |
| E9G8H4 | 5-147 | None |
| A0A834XPV1 | 433-570 | None |
| A0A482VG50 | 232-378 | None |
| A0A212EXQ8 | 82-215 | None |
| A0A4C1U9B2 | 36-171 | None |
| T1GEK9 | 1-122 | None |
| A0A182MPC2 | 48-173 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.