DPCstruct | MC41979
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 131 ± 13 aa |
| Standard deviation of domain lengths | 13.11 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.92 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 32.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0240 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A257MBC9 | 1-118 | MTAEKVAKIGFLINPIAGMGGRVGLKGTDGLAASQALAKGAAPQSEERARVCLRYLLQKTTDLQFLTAGGKMGENALAQCGLTYEVI… |
| A0A662IAQ0 | 2-139 | KKLVFIVNPIAGLGGPLALKGSDNIELMFKLLFSEIGPENSRAQKRAKQFISNLTEKDKVEFLTASNLMGEVSLKDFNIKYRIIHQV… |
| A0A3S2XPG2 | 72-200 | None |
| A0A534LLU3 | 385-529 | None |
| A0A509DZW0 | 11-155 | None |
| A0A7C7DPJ7 | 1-144 | None |
| A0A1T5MU89 | 2-99 | None |
| A0A559QKP8 | 8-152 | None |
| A0A5B8S9V9 | 110-229 | None |
| A0A3M8A6Y4 | 16-145 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.