DPCstruct | MC41977
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 92 ± 21 aa |
| Standard deviation of domain lengths | 21.01 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 90.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 38.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF01139 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4WXI7 | 8-98 | LEKLDENRYVVRRSGAMRVDGIIYIDEELLGYLGTDESIEQVRNVATLPGIVRASLAVPDIHWGYGFPIGGVAAFDVDEGVISPGGV… |
| X1QQC9 | 1-76 | MRTDGLIYASEEMIEKIKQDQAPEQIANVATLPGIVGYAMAMPDIHWGYGFPIGGVAAFDTEKGIISPGGVGYDIN |
| A0A2V6XT53 | 257-350 | None |
| A2DG81 | 15-122 | None |
| A0A2H9TNN6 | 27-130 | None |
| T1GKY9 | 13-123 | None |
| A0A0S9DDI3 | 1-66 | None |
| A0A158QZI0 | 531-632 | None |
| A0A0G1HLX9 | 2-66 | None |
| A0A0K0EKR2 | 885-998 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.