DPCstruct | MC41974
Metacluster Properties and Pfam Annotations
| Number of structural domains | 6 |
|---|---|
| Mean domain length (aa) | 298 ± 20 aa |
| Standard deviation of domain lengths | 19.95 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 65.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.53 |
| Mean length-normalized TM-Score | 0.27 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A835UKE1 | 1-276 | MASGDWFKAIISRKSAKPGRLKQLKQGPPKELPTGSKERNKSNKSSKMFYNGSCDRLSIENVAATHIQAAYRGYLARKKLHYIRKTK… |
| A0A7I8KJ09 | 1-272 | MGSGDWLKTIITLKKIRSSKSKNSKDLTAEESNGFKSNESGENPNKLSRKASGGVSGISDEGTAATRIQTAFRCHKARKILQSLRGE… |
| B9S5W5 | 1-303 | None |
| A0A0A0M0F0 | 1-313 | None |
| A0A022PX18 | 1-329 | None |
| A0A438D2F9 | 1-294 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.