DPCstruct | MC4197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 160 ± 47 aa |
| Standard deviation of domain lengths | 46.83 |
| Length coefficient of variation | 0.29 |
| Mean AlphaFold2 pLDDT confidence score | 69.65 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.72 |
| Pfam Score | 86.11 |
| Assigned Pfam label(s) | CL0123- PF18192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A672GGE6 | 91-191 | SPFRVKPKAEPVKREGPKWDPSRLSETSTFVLGSRANKALGMGGTRGRIYIKHADLFKYAADSKDKQWLAERHHMRATGGKMAYLLI… |
| T1IDB2 | 14-138 | SVSLHKNANTTATNLPSDQFLNARKRKVSDTDKESTQRKRSYPPLMKWDPSRVTKDTQFILSTCASKALGLGAIRGRLSMKHPEIVK… |
| A0A0N5AHR4 | 73-248 | None |
| A0A132AIZ4 | 3-189 | None |
| A0A087W113 | 342-470 | None |
| A0A0R4IMU0 | 1-124 | None |
| A0A6F9DB46 | 63-323 | None |
| A0A452IK04 | 1-100 | None |
| A0A653BZG9 | 21-230 | None |
| A0A183HP55 | 6-146 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.