DPCstruct | MC41965
Metacluster Properties and Pfam Annotations
| Number of structural domains | 24 |
|---|---|
| Mean domain length (aa) | 432 ± 123 aa |
| Standard deviation of domain lengths | 122.69 |
| Length coefficient of variation | 0.28 |
| Mean AlphaFold2 pLDDT confidence score | 82.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.42 |
| Mean intra-cluster sequence similarity (%) | 15.63 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF20211 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C4KAE8 | 95-451 | TGYLKALSRSPDAATEFFLAGHKKEDGTKGTNFTYLFEEREWPEDGRGGKGEVTGHNALGLALEAATTGHRPGERATFDDLKHNAAQ… |
| A0A5P2W9K3 | 4-254 | QPGQHSLQQAQVMKTVVMAVDESLEKTSGHIDAALRVPFAESLADYAADTASTIGLGDRDYVRNGSPSKPAWKDDEGVHMAVPRYTL… |
| A0A7M3LZ81 | 3-294 | None |
| A0A7Y5TBQ4 | 287-764 | None |
| A0A1H0UGZ8 | 142-505 | None |
| A0A7W0CJS7 | 3-626 | None |
| A0A329XLR3 | 47-677 | None |
| A0A1H4ZDK8 | 4-540 | None |
| A0A2T0MSP6 | 68-667 | None |
| A0A197SNF0 | 15-306 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.