DPCstruct | MC41964
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 309 ± 55 aa |
| Standard deviation of domain lengths | 54.60 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.37 |
| Mean intra-cluster local Distance Difference Test score | 0.51 |
| Mean intra-cluster sequence similarity (%) | 14.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1R0V9M6 | 12-320 | SDAMLRQCDELEEKLARSVNELERRRLDARTHQVMAGMQDILVEMQQREQRAAAAASVPHEPVVPLRVDYADKISARLASLRVDAPE… |
| E7AB91 | 52-383 | QELARQEIKKENAAKNAQQNCRDLQANLQKMQAQGLDTFVSLQSLKQELKSLQTLIQTDPLKAQQQSLEALYNLKKLQRQALGLQRA… |
| A0A7C5LLY4 | 232-463 | None |
| D4RXQ5 | 56-338 | None |
| A0A3E2VWE8 | 2-373 | None |
| A0A1V6HXV0 | 117-440 | None |
| A0A1F3X852 | 63-317 | None |
| A0A4R7UY26 | 20-383 | None |
| A0A428WES6 | 6-470 | None |
| A0A7C5ZDW2 | 19-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.