DPCstruct | MC41963
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 109 ± 11 aa |
| Standard deviation of domain lengths | 11.03 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 32.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0479 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A535KVP2 | 199-300 | AHAIIHDKIVVIDPFGESVVVTGSHNLGFTASYANDENLLIVKGNQPLAAAYATHAMDIYDHYRWRYWLQTQKARAWTGLDVTPAWQ… |
| A0A5Q3QJQ6 | 457-564 | IHNKFMLVDPLGDNPIVVTGSANFSKPSQRSNDENMLVIVGDTRVADIYFGEFMRIFDHHYVRYLKRKFDNSDKDKNKSSGYLAEDG… |
| A0A5S4V5E7 | 327-450 | None |
| K0S6X5 | 1064-1175 | None |
| A0A813KFV4 | 373-465 | None |
| A0A7R6YD77 | 56-165 | None |
| A0A3R7DNH9 | 2-96 | None |
| A0A816CPG7 | 58-163 | None |
| A0A2V3U172 | 43-177 | None |
| A0A7V8KLS2 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.