DPCstruct | MC4196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 144 ± 16 aa |
| Standard deviation of domain lengths | 15.51 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.03 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H0Y093 | 192-318 | VLKLLSDFLDSEVSELRTAAAEGLAKLMFSGLVSSRVLYHLILLWHNPVTEEDVRLRHCLCVFFPMFAYASRTHRECFEEAFLPNTQ… |
| T1IBX6 | 1-149 | MRNIVPNFVLLLQSNVPNMRATICQGLAKLLLASHINSPLVLANLILIWFSPITEKEPLVRQPLGVFFSIFSRKRPGASEIIVNAVV… |
| L9J8V6 | 280-457 | None |
| A0A183N605 | 407-556 | None |
| A0A0N1IQX0 | 1-160 | None |
| A0A2P8ZBT5 | 262-402 | None |
| A0A3M7T055 | 405-542 | None |
| A0A7S3A7R7 | 41-174 | None |
| A0A7S4MGF0 | 163-286 | None |
| A0A6L5CAH2 | 7-140 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.