DPCstruct | MC41958
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 178 ± 14 aa |
| Standard deviation of domain lengths | 14.12 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 25.86 |
| Pfam Score | 90.00 |
| Assigned Pfam label(s) | CL0100- PF07086 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2NMQ4 | 1-187 | MASRGGPTVEGTDGTDFMHRQRVASQYQLSALNKSRLKSCIFVHILLFFILLLKLTPDVLDRLDIFVLELEELEVPKPLKWEFWYII… |
| A0A822DRB4 | 2-148 | RLRLLIYLHFILAFLVLIQIITYHIRLIKTVNIPRPHLWQYIWVISILPSLCGLISMNKNHVYLLRLFFRGTVIFGLGTIMTTIILN… |
| A0A445FWY3 | 139-331 | None |
| A0A182VQQ7 | 150-341 | None |
| A0A6S7FT51 | 1-172 | None |
| A0A4S4D6L9 | 65-228 | None |
| A0A498KM69 | 242-412 | None |
| A0A6I9PVS3 | 51-234 | None |
| A0A7S3C3V3 | 5-200 | None |
| A0A4U5TZB3 | 738-909 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.