DPCstruct | MC41953
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 280 ± 72 aa |
| Standard deviation of domain lengths | 71.68 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 71.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.61 |
| Mean intra-cluster sequence similarity (%) | 23.54 |
| Pfam Score | 72.25 |
| Assigned Pfam label(s) | CL0229- PF02207 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D2NBA1 | 42-327 | LFTKRPYPDPDQDNEVADDSMIQCIICEDWLHFKHCLGYLNTEFETVEEDFELICGSCMSRLSFLQHYAHLTLKPSVTGITGADNKK… |
| A0A0N0RSA2 | 83-366 | CSVACHGDHELVELFHRRHFRCDCGTPNLYRLCPDTPHKRDTGYPADARPCQLRSKDVNKGWDVPNDENVYTHNFEGAFCRCERGKT… |
| A0A4U5TVB7 | 3-180 | None |
| A0A7J5Y5Y9 | 154-502 | None |
| G1Q8T3 | 1-130 | None |
| A0A4C1ZKD9 | 647-804 | None |
| A0A5J5C6H3 | 45-295 | None |
| A0A6S7GXI3 | 14-270 | None |
| A0A109FKP9 | 17-441 | None |
| A0A4Z2J1W1 | 13-222 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.