DPCstruct | MC4195
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 92 ± 7 aa |
| Standard deviation of domain lengths | 7.23 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 71.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1I4Y9 | 1-111 | MGDIKNFLIRSGISVQIRRTDGRTHPAIVSNVNSAMQTVTVEWFERGETKGKEIDFATIYALNANLHPTSNINNQSLDTTSNIERER… |
| A0A423TXM6 | 1-91 | MEEANIGGLGVGVTVDIQRTDGRVHSATCSAVNPATRSVTVEWFEKGETKGKEIEFDAVFALNPDLAPQDQNAMPPPSRFDDDDEES… |
| A0A7R9DYG5 | 1-92 | None |
| W5JUL0 | 4-86 | None |
| A0A3B0K7Q2 | 3-87 | None |
| A0A1X7SRC2 | 1-90 | None |
| A0A1I8I6U1 | 209-305 | None |
| A0A183HIN4 | 16-98 | None |
| A0A183JEA8 | 1-95 | None |
| A0A226PFP1 | 1-92 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.