DPCstruct | MC41949
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 214 ± 31 aa |
| Standard deviation of domain lengths | 30.62 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 88.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| B9NXH1 | 297-494 | GASKPIEEISVGDIVVSYDAEGRLRPGRVTRLFRNRVRHVLDVFGLKVTPGHVTLCGDGVFEGRHVPILDILRSDGALVRADGSKVR… |
| A0A2D8HIU9 | 4-219 | GSTKSIETIEIGDEVMAYDPEAEAEAGRGGLWPARVTRTMVNQVPHLLDFHGVRVTPGHATLSGDGPHAGKHIPLMDILTQDGAVVN… |
| A0A545TP92 | 157-394 | None |
| A0A545TMZ1 | 18-236 | None |
| D0CQL4 | 26-211 | None |
| A0A4P7JFJ9 | 109-361 | None |
| A0A4P7JF94 | 66-239 | None |
| B9NXG8 | 184-480 | None |
| A0A839P821 | 189-390 | None |
| A0A2N5XXG2 | 203-428 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.