DPCstruct | MC41947
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 124 ± 25 aa |
| Standard deviation of domain lengths | 25.10 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 78.75 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 38.66 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0J9SMH8 | 21-125 | KKCIDFMVYCVNREELKKQCVDTENTYLKQQYCTNFDKFTDKYYGEFKKEISCLRNTNKDYNWTFSDTCTLHNMAITFPKYNASTGK… |
| A0A0J9T401 | 2-108 | EKCVDFMVYCVNRDELQKHCEQDYNDGLKKRYCNNFNEYTKYYYDQFKSKIKCLKDSNKDIHYNWRFSDTCTLHNVAKTFPKYDEKK… |
| A0A0J9S302 | 87-262 | None |
| A0A0J9SLZ2 | 2-106 | None |
| A0A0J9SIT8 | 1-102 | None |
| A0A0J9SFC1 | 127-231 | None |
| A0A1A9AIN5 | 104-260 | None |
| A0A1D3JFV3 | 85-237 | None |
| A0A1G4ECH4 | 1-102 | None |
| A0A0J9W6B4 | 118-250 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.