DPCstruct | MC41944
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 172 ± 18 aa |
| Standard deviation of domain lengths | 17.67 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 88.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 17.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| C9R9E8 | 91-261 | EEDRVLAELQGQVVNLLKEMYRHYQILSIATNCLSFAREGKRAEAIFATQVRHRIGVASPSEWPVQKGRIKFLEENRSKLTPEQIRQ… |
| A0A2R3MWF6 | 13-201 | FVCVFIVCSIGQIEEGTDVSGAKRNETFEFEPIIRQILDGYQSFYRLENFETSTFEFEVDGVPYLGIDVSVDMTLTCHPKELPYFKG… |
| A0A265Q1L9 | 34-217 | None |
| A0A3D3UZD5 | 1-190 | None |
| A0A2H9MCP5 | 33-211 | None |
| A0A3D1YZW0 | 5-187 | None |
| A0A6N7Y2X7 | 23-202 | None |
| A0A398D4Q4 | 180-360 | None |
| A0A7X7ACD6 | 29-161 | None |
| A0A7X6WKY4 | 34-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.