DPCstruct | MC41937
Metacluster Properties and Pfam Annotations
| Number of structural domains | 57 |
|---|---|
| Mean domain length (aa) | 133 ± 23 aa |
| Standard deviation of domain lengths | 23.44 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 92.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 26.00 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0341 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V5FCB8 | 179-329 | HMKERQLAEIERVARGEQAVHWQTSGEEMSAIIRSVLTGRPTTAIINAPNRGQIDNLPDEVVVETLATVSSAAIEPMRCGPLPAAIA… |
| M1ZSW1 | 2-116 | MIEVAASIAYNKNKRYIIIVENNGAINNMQDDAMVEVVAELGINGPRPMRVGNIPQFYLGLLVNQVSCEKLLIDAYYEKSYNKALQA… |
| A0A3M1IVK4 | 266-412 | None |
| A0A564MGB3 | 40-143 | None |
| A0A076MSQ3 | 68-209 | None |
| A0A7J2K8Q2 | 67-216 | None |
| A0A1Q6YPG6 | 58-178 | None |
| A0A5C0SMC7 | 4-116 | None |
| A0A838Y082 | 71-201 | None |
| A0A381KJ58 | 815-968 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.