DPCstruct | MC4193
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 10.11 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.99 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 37.55 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1HJX6 | 73-165 | CLVGVIFKLRGQLLNLNFNVARDEAVHLCSMCNQFAVEDTFHYVSVCPVLSEFRVRWLGKKALSESECIEYLNGSDWDKLYNYHMRA… |
| T1I2B3 | 3-97 | SLRWWFKIRGEMLFLNCVPWIEKAAQKEKCALCNLNSREDLHHFLCECPILSEFRLRSLGVKLLDAQYVIDVLGNQHICSDLISFAS… |
| A0A224XCG0 | 351-449 | None |
| A0A6H5GQ90 | 65-141 | None |
| A0A6H5GL82 | 610-717 | None |
| A0A6H5GIP6 | 11-101 | None |
| A0A224XQI4 | 3-97 | None |
| A0A6H5HYZ1 | 222-311 | None |
| A0A6H5H7H7 | 404-494 | None |
| A0A1B0B908 | 684-782 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.