DPCstruct | MC41926
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 282 ± 46 aa |
| Standard deviation of domain lengths | 45.80 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 65.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.63 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 27.24 |
| Pfam Score | 83.33 |
| Assigned Pfam label(s) | CL0500- CL0263 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V7Z9W3 | 21-232 | QDQRAVQPARLRQALYRANDLALPLLRSRLAPIDITPIWPQLSAVCHDVALCYCSVQAPLPAVLERLLQPILPSKKMASAMLAALRD… |
| A7WK44 | 7-274 | TPDWDDVERTLKDTFDTVNQSFDRGWTSTQDEWHGFTRRISLRVTSIFGDMGPDRIDAVKEALRLSYPIILTRLSRRWASIEIDQII… |
| A0A261WC82 | 1-337 | None |
| A0A2S8GXB2 | 4-292 | None |
| A0A3S0SBM0 | 10-321 | None |
| A0A4P8HRS8 | 3-334 | None |
| A0A656GB48 | 4-247 | None |
| A0A840MH65 | 30-249 | None |
| A0A2V4Y7E3 | 1-327 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.