DPCstruct | MC41924
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 91 ± 12 aa |
| Standard deviation of domain lengths | 11.94 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.70 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 46.48 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6J0ZXZ8 | 1-104 | MDATAEMPDAMGIIYKKALTIGTSGAVDEYMENKGSAAASYSKAMLLLSFIIGEAMNLPLKPPFSLAPAVKKQIQSYINHLQSHQCQ… |
| A0A0A9ILE2 | 24-113 | ISDATEMPDAIEIIFQSALQLGRRGGVDEMMGKAAVAMSRYMKAVSMLCFLLIEAPSLVLNPPLTLTRSDRHRLRTYIEALNTRLGQ… |
| A0A287PXT9 | 263-351 | None |
| A0A2P2N6H5 | 1-92 | None |
| A0A5D2KHI6 | 1-68 | None |
| A0A7S3E3I0 | 131-233 | None |
| A0A0K9QPC1 | 571-664 | None |
| A0A6P5GLC4 | 507-583 | None |
| A0A0P0VVW5 | 91-179 | None |
| A0A6G1DUB0 | 619-707 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.