DPCstruct | MC4192
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 130 ± 13 aa |
| Standard deviation of domain lengths | 12.88 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 83.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K1PM57 | 92-209 | WHVDFYPQGVIFKPCLMIGLFWNCEIDEVVYETVRLTVTSNSSEYRRVQISALIYGQQDGHEYVAKCVTRTCYFDSEHPSHNFNDLM… |
| T1HZ58 | 1-162 | MAEDKLESYMEQVVHQVIDLNPKGVWFPKFQLIVWQGTIEVPESVLSTVRLSITCKDIVDDYFKVKIGLLVMGIQDGIEVVLKVVEK… |
| A0A2T7NHZ0 | 400-520 | None |
| W5JPG1 | 373-498 | None |
| A0A0N1I8X7 | 81-201 | None |
| A0A1J1HST2 | 972-1106 | None |
| A0A182HAF8 | 245-371 | None |
| A0A423UBE3 | 1-132 | None |
| A0A7R9G3U9 | 118-256 | None |
| A0A0K8VIG4 | 77-192 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.