DPCstruct | MC41918
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 425 ± 45 aa |
| Standard deviation of domain lengths | 44.57 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 78.03 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 22.30 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | CL0023- CL0257 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0FYW9 | 350-760 | DTGPPEGPSKKRKQGELGAGPRRTPCWLTASSTHTLAVEVENDQACQDVAEAFEYDFEGHTETRLPCLGGNAARLCATARVAAIVGP… |
| B2JU84 | 3-369 | KYEFTLSSPVATTFRSSKAANSLDIDVKKKSTHHVCVSADVESAYHVGLIVGASGSGKTTLAQHIYGDACFTTLLDPTQPVIEQFPE… |
| A0A812HBB8 | 225-597 | None |
| A0A7V3TV63 | 53-521 | None |
| A0A7S3LGX9 | 124-570 | None |
| A0A7S4A0L3 | 235-650 | None |
| A0A7V9AC49 | 1-402 | None |
| A0A813AVM4 | 1-493 | None |
| A0A212JEV0 | 24-512 | None |
| F0YA26 | 254-635 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.