DPCstruct | MC41917
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 151 ± 26 aa |
| Standard deviation of domain lengths | 25.75 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 80.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 20.16 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S4RG59 | 4-163 | SMVVLLSRGALEDPDFATALGCALGAEIPLVPVKVDGDFHYPDADFYQQLVSGRFFALDSDSALVNAKVSYERLLALAPVHVSLSAP… |
| A0A812RTA6 | 1-99 | SRGALQDATFAQLALTIRKEGIEFVPVNDGSFQFPSPEFYRKVEGGDIAIAGLAIEVGPSLAKAYQAILSILALPFAPHGSSGILDR… |
| A0A7S4M8E1 | 1-167 | None |
| A0A7S2ISR5 | 2-120 | None |
| A0A7S3FIL5 | 2-141 | None |
| A0A7S0F3X5 | 301-459 | None |
| A0A813DK86 | 92-259 | None |
| A0A7S2M1F1 | 1-138 | None |
| A0A7S4F0B9 | 749-937 | None |
| A0A7S4BXK9 | 376-562 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.