DPCstruct | MC41904
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1157 |
|---|---|
| Mean domain length (aa) | 222 ± 43 aa |
| Standard deviation of domain lengths | 43.05 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 83.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.46 |
| Mean intra-cluster sequence similarity (%) | 15.77 |
| Pfam Score | 76.28 |
| Assigned Pfam label(s) | CL0489- PF17098- CL0020- CL0010- CL0336 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5N9AJB9 | 7-224 | EATITSIVDESPSVKSFGMSLSGPNFDFFPGQYIDLFVDTPTGIVVGGYSITSSPIDNNNNISIAVKKIDGALATIQLHDKTNIGDV… |
| D0P131 | 2-159 | KLPANPQDPIVMAGLGTGMAPFRAFIQERAFLRSQGVKVGPVALYFGSRHKAKEYLYGDELDAFEADGLVTYLRCAFSRDQEHKVYI… |
| A0A7S3ZLD7 | 20-265 | None |
| A0A3S2XMH1 | 19-241 | None |
| A0A3D0I2B1 | 164-378 | None |
| A0A7S4A819 | 145-414 | None |
| A0A438N4X5 | 193-444 | None |
| A0A5A9GGA0 | 789-1029 | None |
| A0A5N6E8F2 | 143-409 | None |
| A0A6A5X2B5 | 181-361 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.