DPCstruct | MC4190
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 132 ± 10 aa |
| Standard deviation of domain lengths | 10.40 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 88.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 27.85 |
| Pfam Score | 91.67 |
| Assigned Pfam label(s) | CL0205- CL0159 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J6ZUB9 | 364-520 | ESFGVIGDSTTAMRDPVFYRWHAYIDDIFQQFKGTLPRYAVNQLNYDGVTVTSCEVQSQNTPANQLNTFWQQSDVDLSRGMDFQPRG… |
| T1HUM9 | 5-127 | SEVDLEKTYFSLLSFPGVSVIDFQYDEFVTYFEKFDYEVTNGIPMKDPYDYTDYIYHAQQYRLNHRPYTFKITINSAKQTDAVVRVF… |
| T1GK98 | 1-139 | None |
| A0A7R9FWB4 | 486-603 | None |
| A0A226EMK4 | 432-570 | None |
| A0A482WS29 | 539-673 | None |
| A0A1D2N840 | 1-113 | None |
| A0A6V7LHE6 | 200-326 | None |
| A0A5B7CRV4 | 413-546 | None |
| A0A226ELQ5 | 286-427 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.