DPCstruct | MC419
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 668 ± 68 aa |
| Standard deviation of domain lengths | 68.16 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 71.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.55 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.47 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A420MB11 | 1-704 | MADTVELLGVIGTWVAVVLALVALAGIIPIYILYRQSQTERHVALDAVDDRLNEYVTRGYELLPRKRFFRSVRVPDLTETPKLNAVD… |
| A0A1Y2X9W0 | 1-605 | MSQVVDLASVIGTWVGAGVGVIALIGIVGPVLIWLASRTERHQTLNAIGRYTNGYISPGYHLGPNIYLFQRVQAPLLTTFNIPNPFS… |
| A0A6A5JVV8 | 3-674 | None |
| A0A225AIK3 | 51-660 | None |
| A0A6A5TYW9 | 1-714 | None |
| A0A423VEU4 | 223-787 | None |
| A0A093VS38 | 1-618 | None |
| A0A7C8INK1 | 1-811 | None |
| A0A2I1CF20 | 1-714 | None |
| M2TA24 | 1-663 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.