DPCstruct | MC41896
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 414 ± 68 aa |
| Standard deviation of domain lengths | 67.54 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.77 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.45 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 15.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF13687 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X1NZA1 | 4-427 | SASAVPAPWLSLLVGLMQGLLFWWLQQGAEEAPFPAPWATVLTVPVVMLPLAFSLLGAFLTRDARLTWGTLGVTALTTLAVLSHLTL… |
| A0A2N2PRA8 | 67-446 | RAVAWGWALPLGVLNGLLLWLLSDFQRFKIQVTNPLYGTVHDVMPAVALLAAPISAALIAFFLTLAGKQRWGRVLAVGLGLAAGTAY… |
| A0A2M7R011 | 34-560 | None |
| A0A0W0VH40 | 3-354 | None |
| A0A2G2LWR2 | 28-455 | None |
| A0A0W0SRT7 | 2-369 | None |
| A0A1V5U2B2 | 20-459 | None |
| A0A1Y6K656 | 12-506 | None |
| A0A519L361 | 1-321 | None |
| A0A1F7VGF0 | 2-274 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.