DPCstruct | MC41893
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 180 ± 15 aa |
| Standard deviation of domain lengths | 15.00 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q7X5Y5 | 7-201 | DGGDLVMLMEVSQLKKLALLLRNNEEAQITQAVKSQNERVKYLHSVNHAYNHAVDLLDDGSATRDKYAAAAAGGGGEAKASIAEDVL… |
| A0A6P6GJG2 | 1-162 | MSKKSTITLLDGQELRRLAKLVHYQEVENIKNLQFKSEEDRCKYLKESKAGYKSSLALLDNGEKIKIDYKNDETRSSVAHTIFSAME… |
| A0A6P4B918 | 1-185 | None |
| A0A7C9AXL8 | 5-157 | None |
| A0A314YX17 | 1-187 | None |
| A0A0E0P760 | 1-201 | None |
| A0A6P4BIV7 | 2-189 | None |
| A0A6P6GLG1 | 5-200 | None |
| A0A6J1DWX6 | 1-161 | None |
| A0A5P1FVH1 | 1-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.