DPCstruct | MC41892
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 7.89 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 73.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.42 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 57.69 |
| Pfam Score | 94.60 |
| Assigned Pfam label(s) | CL0125- PF00566- CL0214 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6GC96 | 6-70 | VNKKLLEELEGMGFPTARATRALHYSGNSSLEAAVNWVVEHENDTDIDEMPMVPASTKVEASKPS |
| A0A251TEY1 | 1-58 | MDVEGVNKKLVDELEEMGFPLPRAMRALYYSGNSSLEDAINWIVDHEDDPDIDQMPSV |
| A0A1R3J198 | 102-175 | None |
| A0A817B9W6 | 107-174 | None |
| A0A5J5V6M8 | 5-82 | None |
| A0A0D3C7M4 | 1-51 | None |
| A0A2G3AVC7 | 105-167 | None |
| A0A1D6Q273 | 104-182 | None |
| A0A5J5C5G3 | 179-252 | None |
| A0A821JP84 | 145-220 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.