DPCstruct | MC41891
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 114 ± 22 aa |
| Standard deviation of domain lengths | 22.22 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 79.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 39.02 |
| Pfam Score | 97.83 |
| Assigned Pfam label(s) | PF07911- PF01015- CL0110 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P6G8S7 | 7-108 | EAISSGGIDVVNCYCCGLTEECSFAYIARMRERYGRWICGLCAEAVKDQALRFNLCTEEAVKQQMKFRQQFKLSNPPVNATEHLISA… |
| I1K9F3 | 34-128 | AIEEVEQAECQCCGMKEDCTTVYITEVQECYCGKWVCGLCSEVVKERVGRSPKVAMQDALNSHRDFCQEYNATTRLNPQLSLTLSMR… |
| I1N270 | 6-133 | None |
| A0A7J7CKK0 | 3-105 | None |
| A9RCV5 | 1-83 | None |
| A0A2K2DPP8 | 76-207 | None |
| A0A2T7E1R6 | 184-326 | None |
| A0A6S7N9W3 | 9-116 | None |
| A0A6D2I7X3 | 29-156 | None |
| A0A0D9V5J6 | 276-414 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.