DPCstruct | MC4189
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 60 ± 4 aa |
| Standard deviation of domain lengths | 4.20 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 81.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 57.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A839PNH6 | 78-135 | EAEIESCPICDVPFTAGDLCATDIEMGMCHAACLEGSPVVDLENGEPSDGPISTYPYE |
| A0A3A1WIW5 | 2-58 | ADDKPICEICGTEIVVGDLCANETEMGMVHAECLAGAPVVNDEGEETDAPLFTYRWD |
| A0A6A8AEP7 | 2-59 | None |
| A0A0Q8ALQ3 | 3-60 | None |
| A0A1M2Z3X8 | 140-206 | None |
| A0A4Z1QYY4 | 43-103 | None |
| A0A4S0S5H3 | 7-65 | None |
| A0A0N0JAZ3 | 98-154 | None |
| A0A4Z1Q1M4 | 207-266 | None |
| A0A6S6MWX8 | 258-316 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.