DPCstruct | MC41887
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 207 ± 39 aa |
| Standard deviation of domain lengths | 38.91 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 89.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 25.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0126 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1TMP1 | 36-255 | AFEVRRTEAFREKSASAEYNPGSLDGTRPGIFYVPIPDVTKYNMYSDESLFLHEAIPGHHYQISLQQENTDLPSFRKTLWYSAYGEG… |
| A0A2B4STL9 | 65-296 | PVEPVISFSPYVGVATHTASSSNCGHAARYNLPFFVDRMGCEYMEWTTTAHEAVPGHHLQEEGFKAIFQPRIAPCPSVLKPSSATAY… |
| A0A7X2PNK7 | 5-147 | None |
| A0A5C6ANG8 | 375-595 | None |
| A0A1Q8JUA3 | 200-420 | None |
| A0A2V7L4M8 | 716-943 | None |
| A0A350IZW6 | 30-247 | None |
| F4Q1T4 | 868-1089 | None |
| A0A179HU15 | 720-981 | None |
| A0A550KJG7 | 332-554 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.