DPCstruct | MC41886
Metacluster Properties and Pfam Annotations
| Number of structural domains | 37 |
|---|---|
| Mean domain length (aa) | 172 ± 29 aa |
| Standard deviation of domain lengths | 29.34 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.62 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 41.38 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00010 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2B4SSK9 | 1-179 | MNIEQLLEAAKIIEQRDEAKKQSQASVKRDRKPTKRSPSYSRTTHNQLEKNRRAHLRDCLELLKELVPSPPEHQKATTLALLQSAQQ… |
| A0A384DCB0 | 9-127 | QRSSHNELEKHRRAKLRLYLEQLQQLVPLGPDSSRHTTLSLLKRAKTHIKKLEEQDRRALSIKEQLQREHRFLKRRLEQLSMQSLER… |
| A0A2I2YVF8 | 39-262 | None |
| A0A402FF67 | 76-237 | None |
| A0A7J5YTB9 | 57-246 | None |
| A0A7F8R1X1 | 21-179 | None |
| A0A6I9PNU7 | 1-125 | None |
| A0A7E5W6R6 | 27-204 | None |
| A0A6A4VAL6 | 4-131 | None |
| A0A2K6F884 | 27-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.