DPCstruct | MC41885
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 193 ± 15 aa |
| Standard deviation of domain lengths | 15.10 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 69.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.48 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 27.13 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7D9LGB4 | 1-195 | MEYIRDGCRENGETINNGQLREVDDVAPRAVIKRLYKAGTISSDNVEQLKEVSSCYCVEEKDVESYVKHLEELKMMSDIRENERRKK… |
| A0A6J8ERH2 | 1-155 | MPPVPRPYPDYEQLPQFHYLQHKDTPISIDGVQRRHDDFQPRSNLKKLFSEGEISSVDDNEIETERKEQLIIKKRQDEGAKGYEYYD… |
| A0A3M6USW5 | 168-349 | None |
| A0A6J8EB34 | 213-386 | None |
| A0A2B4S5K9 | 246-434 | None |
| A0A2B4S052 | 1-182 | None |
| A0A6J8DA71 | 289-481 | None |
| A0A7D9HDS3 | 377-577 | None |
| A0A7D9ESJ7 | 93-300 | None |
| A0A7D9JGR4 | 465-658 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.